SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P91829 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P91829
Domain Number 1 Region: 93-341
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-51
Family Nuclear receptor ligand-binding domain 0.0000278
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-30
Family Nuclear receptor 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P91829
Sequence length 373
Comment (sp|P91829|NHR69_CAEEL) Nuclear hormone receptor family member nhr-69 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=nhr-69; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MVEEICHICNDKSTGKHYGAISCDGCKGFFRRSIRKRYHYQCRFEQNCDVTKNKRNACRA
CRLQKCVKAGMKSNAIQNERDAIGKRKKTTGAEKEDLIDQLVAAETLCQQLRSSVIKNTS
SLAPYDCGKVKWNYEDARAATLDDIGKSIHQQLVLFIEWAKSLPQFSFLAQADQAALLKG
GAASIIVLGVAYRSICLTVENTICLANDTLLPKEHATQVGDINCVVGRIIDEIVNPMRRL
NMDLIEYVALKAILFFNPVVREINDQSPVENARYAFLRSLQRRCTDKALENMEDESMDCR
SGKLLLLLPSLQAIAQQLVEDVQLARLFGLVNVDSLMEELILNDMKPSDPQILQTSLASP
VNSSVKAEVELEE
Download sequence
Identical sequences P91829
6239.T23H4.2.2 T23H4.2 NP_492615.2.50509 T23H4.2 G_YK8799 T23H4.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]