SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P98083 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P98083
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-64
Family Phosphotyrosine-binding domain (PTB) 0.0000000059
Further Details:      
 
Domain Number 2 Region: 467-571
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-27
Family SH2 domain 0.00000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P98083
Sequence length 579
Comment (sp|P98083|SHC1_MOUSE) Src homology 2 domain-containing-transforming protein C1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Shc1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGLLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGDHEVRKQMLPPPPCPGRELFDD
PSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMKPFEDALRVPPPPQSMSMAEQLQ
GEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRT
KDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV
Download sequence
Identical sequences P98083
10090.ENSMUSP00000091940 ENSMUSP00000119293 ENSMUSP00000091940 ENSMUSP00000091940 NP_001106802.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]