SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q01850 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q01850
Domain Number - Region: 25-136
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q01850
Sequence length 454
Comment (sp|Q01850|CDR2_HUMAN) Paraneoplastic cerebellar degeneration-associated antigen KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CDR2; OC=Catarrhini; Hominidae; Homo.
Sequence
MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQL
QEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIE
CLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEK
ITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGAT
GAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPE
SHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKY
EELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPP
EYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
Download sequence
Identical sequences Q01850
gi|55770832|ref|NP_001793.1| NP_001793.1.87134 NP_001793.1.92137 XP_005276559.1.87134 ENSP00000268383 ENSP00000268383 9606.ENSP00000268383 ENSP00000268383 NYSGRC-55770832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]