SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q021C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q021C3
Domain Number 1 Region: 29-305
Classification Level Classification E-value
Superfamily TPR-like 4.66e-33
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 
Domain Number 2 Region: 316-480
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000968
Family Thioltransferase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q021C3
Sequence length 484
Comment (tr|Q021C3|Q021C3_SOLUE) Tetratricopeptide TPR_2 repeat protein {ECO:0000313|EMBL:ABJ84466.1} KW=Complete proteome; Reference proteome OX=234267 OS=Solibacter usitatus (strain Ellin6076). GN=Acid_3493 OC=Solibacteraceae; Candidatus Solibacter.
Sequence
MPIRLWFALSIATLTGYAQPAGCAMDRAVRLHQTGDFPGAIREYQACIAAEPARVEARSN
LGAVLAKLGRYQDAIDQYQAALRMAPRDLASRLRFNLALAYYKSFQIPEAVAEFETLRGE
QPADLNLALLLADCRLRTGDFQAAIDVLTPLEASQPDQPALDYVLGMALLRTGRIPEGQA
RVDRILRRGESAEGRFLLGASLFMAGNFPGAVAEFSKAAALDPNLPSLQSYYGQALLFTG
DADGAAVAFRKELAANPNDFDANFQLASILAHRGKPDEARPLLARAVQVRPGSAEAREAL
GKGFPADQPTQADPGIAVGSRAPAIGTLDLGRPTKPVVLVFGSYTCPKLRSSAAALKRIA
EQYRDRIDFRLVYIREAHAQGGPESQWQSTINIKEGVSLAPARTLPEKQEHAALCLRKLE
LPFPAVIDGMDGAAETAYQAWPSRLYLVGRDGKVAFSTRLGELEFRPADLETAIREILSK
TGVE
Download sequence
Identical sequences Q021C3
234267.Acid_3493 WP_011685227.1.46729 gi|116622595|ref|YP_824751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]