SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q02516 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q02516
Domain Number 1 Region: 94-231
Classification Level Classification E-value
Superfamily Histone-fold 1.29e-36
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q02516
Sequence length 242
Comment (sp|Q02516|HAP5_YEAST) Transcriptional activator HAP5 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=HAP5; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTDRNFSPQQGQGPQESLPEGPQPSTMIQREEMNMPRQYSEQQQLQENEGEGENTRLPVS
EEEFRMVQELQAIQAGHDQANLPPSGRGSLEGEDNGNSDGADGEMDEDDEEYDVFRNVGQ
GLVGHYKEIMIRYWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISA
EAPIIFAKACEIFITELTMRAWCVAERNKRRTLQKADIAEALQKSDMFDFLIDVVPRRPL
PQ
Download sequence
Identical sequences A0A0L8VH22 A0A250WA42 A6ZPI8 B3LK15 B5VSN6 C7GNR0 C8ZHA8 E7KIM5 E7KUS9 E7M0U6 E7NMW1 E7Q9T7 E7QL49 G2WNL9 H0GP46 N1NZ05 Q02516
YOR358W YOR358W YOR358W 4932.YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W YOR358W tr|A6ZPI8|A6ZPI8_YEAS7 YOR358W YOR358W SCRT_01733 YOR358W NP_015003.1.97178 YOR358W YOR358W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]