SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q028K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q028K1
Domain Number 1 Region: 200-352
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-22
Family Glutathione peroxidase-like 0.014
Further Details:      
 
Domain Number 2 Region: 98-181
Classification Level Classification E-value
Superfamily TPR-like 0.0000194
Family Tetratricopeptide repeat (TPR) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q028K1
Sequence length 353
Comment (tr|Q028K1|Q028K1_SOLUE) Redoxin domain protein {ECO:0000313|EMBL:ABJ82551.1} KW=Complete proteome; Reference proteome OX=234267 OS=Solibacter usitatus (strain Ellin6076). GN=Acid_1560 OC=Solibacteraceae; Candidatus Solibacter.
Sequence
MARSKPAESRLQAGLPAPQGEAPSFRRVRANRCTVIQGEPQMMRANKRSVIPILLLLALT
AYGQQPSLINAVRTLIAGHDVPAAERLARSYQARTGPTPELAAAFSWIARAQFDAKNYDQ
ADALAQETTKIASRFLMGQKLDDDPWLPTAQGAAIEVHAQVLAARGERAEALEYLRGQLK
QFTGTSLAERIRKNINLLSLEGKPAPPLEEKEWLGPKPPSLAALRGHPVLLFFWAHWCSD
CKAEIGIIANLRRTFAPQGLAVIGPTRLYGYVAGGEDAPAEKEKLYIEQVRKRFYADLLD
MPAPLSAANFVAYGASSTPTLVLIDGGGIVRYYHPGNASEAELTARIRAALRK
Download sequence
Identical sequences Q028K1
234267.Acid_1560 gi|116620680|ref|YP_822836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]