SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q02934 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q02934
Domain Number 1 Region: 76-523
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.67e-161
Family Cellulases catalytic domain 0.00000000000897
Further Details:      
 
Domain Number 2 Region: 738-887
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.88e-55
Family Cellulose-binding domain family III 0.00000766
Further Details:      
 
Domain Number 3 Region: 532-683
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.37e-51
Family Cellulose-binding domain family III 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q02934
Sequence length 887
Comment (sp|Q02934|GUNI_CLOTH) Endoglucanase I KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=celI; OC=Ruminiclostridium.
Sequence
MRLVNSLGRRKILLILAVIVAFSTVLLFAKLWGRKTSSTLDEVGSKTHGDLTAENKNGGY
LPEEEIPDQPPATGAFNYGEALQKAIFFYECQRSGKLDPSTLRLNWRGDSGLDDGKDAGI
DLTGGWYDAGDHVKFNLPMSYSAAMLGWAVYEYEDAFKQSGQYNHILNNIKWACDYFIKC
HPEKDVYYYQVGDGHADHAWWGPAEVMPMERPSYKVDRSSPGSTVVAETSAALAIASIIF
KKVDGEYSKECLKHAKELFEFADTTKSDDGYTAANGFYNSWSGFYDELSWAAVWLYLATN
DSSYLDKAESYSDKWGYEPQTNIPKYKWAQCWDDVTYGTYLLLARIKNDNGKYKEAIERH
LDWWTTGYNGERITYTPKGLAWLDQWGSLRYATTTAFLACVYSDWENGDKEKAKTYLEFA
RSQADYALGSTGRSFVVGFGENPPKRPHHRTAHGSWADSQMEPPEHRHVLYGALVGGPDS
TDNYTDDISNYTCNEVACDYNAGFVGLLAKMYKLYGGSPDPKFNGIEEVPEDEIFVEAGV
NASGNNFIEIKAIVNNKSGWPARVCENLSFRYFINIEEIVNAGKSASDLQVSSSYNQGAK
LSDVKHYKDNIYYVEVDLSGTKIYPGGQSAYKKEVQFRISAPEGTVFNPENDYSYQGLSA
GTVVKSEYIPVYDAGVLVFGREPGSASKSTSKDNGLSKATPTVKTESQPTAKHTQNPASD
FKTPANQNSVKKDQGIKGEVVLQYANGNAGATSNSINPRFKIINNGTKAINLSDVKIRYY
YTKEGGASQNFWCDWSSAGNSNVTGNFFNLSSPKEGADTCLEVGFGSGAGTLDPGGSVEV
QIRFSKEDWSNYNQSNDYSFNPSASDYTDWNRVTLYISNKLVYGKEP
Download sequence
Identical sequences Q02934 Q9L3J8
WP_011837740.1.31213 gi|125972564|ref|YP_001036474.1| 203119.Cthe_0040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]