SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q03385 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q03385
Domain Number 1 Region: 50-211,306-612
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-124
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 727-821
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.94e-41
Family Ras-binding domain, RBD 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q03385
Sequence length 852
Comment (sp|Q03385|GNDS_MOUSE) Ral guanine nucleotide exchange factor KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ralgds; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MMVDCQSSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRT
VKAGTLEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSR
YGCILPYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGS
DLERRAHLLLAQLEDLEPSEAESEALSPAPVLSLKPASQLEPALLLTPSQVVTSTPVREP
AAAPVPVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESAPVPTPAL
EPSWSLPEATENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKG
KEHLAPTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSSL
YAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFAT
LEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVI
AQIKLLQSACNNYSIAPEEHFGTWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKST
AIVKRWSDRQAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEI
NMSFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGV
CSYSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDE
PEDYELVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPRM
KQKGLRIAKGIF
Download sequence
Identical sequences Q03385
ENSMUSP00000028170 NP_033084.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]