SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q05332 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q05332
Domain Number 1 Region: 42-448
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-75
Family beta-glycanases 0.00000111
Further Details:      
 
Domain Number 2 Region: 497-564
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.79e-18
Family Type I dockerin domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q05332
Sequence length 566
Comment (sp|Q05332|GUNG_CLOTH) Endo-1,4-beta-glucanase G KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=celG; OC=Ruminiclostridium.
Sequence
MKKAKAIFSLVVALMVLAIFCFAQNTGSTATTAAAAVDSNNDDWLHCKGNKIYDMYGNEV
WLTGANWFGFNCSENCFHGAWYDVKTILTSIADRGINLLRIPISTELLYSWMIGKPNPVS
SVTASNNPPYHVVNPDFYDPETDDVKNSMEIFDIIMGYCKELGIKVMIDIHSPDANNSGH
NYELWYGKETSTCGVVTTKMWIDTLVWLADKYKNDDTIIAFDLKNEPHGKRGYTAEVPKL
LAKWDNSTDENNWKYAAETCAKAILEVNPKVLIVIEGVEQYPKTEKGYTYDTPDIWGATG
DASPWYSAWWGGNLRGVKDYPIDLGPLNSQIVYSPHDYGPSVYAQPWFEKDFTMQTLLDD
YWYDTWAYIHDQGIAPILIGEWGGHMDGGKNQKWMTLLRDYIVQNRIHHTFWCINPNSGD
TGGLLGNDWSTWDEAKYALLKPALWQTKDGKFIGLDHKIPLGSKGISLGEYYGTPQASDP
PATPTATPTKPAASSTPSFIYGDINSDGNVNSTDLGILKRIIVKNPPASANMDAADVNAD
GKVNSTDYTVLKRYLLRSIDKLPHTT
Download sequence
Identical sequences Q05332
gi|125975353|ref|YP_001039263.1| 203119.Cthe_2872 WP_003514548.1.16390 WP_003514548.1.31213 WP_003514548.1.60145 Cth-1813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]