SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q05922 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q05922
Domain Number 1 Region: 166-314
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-44
Family Dual specificity phosphatase-like 0.000000371
Further Details:      
 
Domain Number 2 Region: 7-151
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.57e-20
Family Cell cycle control phosphatase, catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q05922
Sequence length 318
Comment (sp|Q05922|DUS2_MOUSE) Dual specificity protein phosphatase PAC-1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dusp2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MPIAMGLETACELECAALGALLREPREAERTLLLDCRPFLAFCRSHVRAARPVPWNALLR
RRARGTPAAALACLLPDRALRARLGRGELARAVVLDESSASVAELPPDGPAHLLLAALQH
EMRGGPTTVCFLRGGFKSFQTYCPDLCSEAPAQALPPAGAENSNSDPRVPIYDQGGPVEI
LPYLYLGSCNHSSDLQGLQACGITAVLNVSASCPNHFEGLFHYKSIPVEDNQMVEISAWF
QEAISFIDSVKNSGGRVLVHCQAGISRSATICLAYLIQSHRVRLDEAFDFVKQRRGVISP
NFSFMGQLLQLETQVLCH
Download sequence
Identical sequences Q05922
ENSMUSP00000028846 10090.ENSMUSP00000028846 ENSMUSP00000028846 ENSMUSP00000028846 NP_034220.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]