SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q05B60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q05B60
Domain Number 1 Region: 13-205
Classification Level Classification E-value
Superfamily Nudix 3.37e-30
Family MutT-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q05B60
Sequence length 222
Comment (sp|Q05B60|NUD14_BOVIN) Nucleoside diphosphate-linked moiety X motif 14 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NUDT14; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MERIEGVAVGRCAASPYLVPLTLHYRQNGAQKSWDFMKTHDSVTILMFNSSRRSLVLVKQ
FRPAVYAGEVERLFPGSLAAAEQDRPQALQAALPGSAGVTYELCAGLLDQPGLSLEEVAC
KEAWEECGYRLAPSDLRRVTSYKSGVGLTGSSQTMFYAEVTDAQRGSPGGGLAEEGELIE
VVHLPLDGARTFADDPDVPKTLGVIFGISWFFSCVAPGLGLQ
Download sequence
Identical sequences Q05B60
NP_001099122.1.59421 NP_001099122.1.76553 ENSBTAP00000055697 ENSBTAP00000055697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]