SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q05B74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q05B74
Domain Number 1 Region: 133-308
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.06e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 83-127
Classification Level Classification E-value
Superfamily TGS-like 0.0000654
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q05B74
Sequence length 335
Comment (tr|Q05B74|Q05B74_BOVIN) Mitochondrial ribosomal protein L39 {ECO:0000313|EMBL:AAI22668.1, ECO:0000313|Ensembl:ENSBTAP00000026038} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MRPL39 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAVVVRGMRLWRAAPSGGAAWRSVVTSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTE
KIEVKHVGKTDPGTIFVLNKNVSTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSC
EIKFLTFKDDDPGEVNKAYWRSCAMIMGCVIERAFKEEYVVHLVRAPEVPVIAGAFCYDV
VLDKRLDEWMPTKENLRSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKVDFIEEK
ASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSVVHNLQATQSSLVRRFQGLSLP
VHLRAHFTIWNKLLERSRKMVTEDQTKPTEKSAST
Download sequence
Identical sequences Q05B74
ENSBTAP00000026038 ENSBTAP00000026038 NP_001074199.1.59421 NP_001074199.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]