SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q06828 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q06828
Domain Number 1 Region: 80-358
Classification Level Classification E-value
Superfamily L domain-like 1.62e-50
Family Ngr ectodomain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q06828
Sequence length 376
Comment (sp|Q06828|FMOD_HUMAN) Keratan sulfate proteoglycan fibromodulin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FMOD; OC=Catarrhini; Hominidae; Homo.
Sequence
MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEG
PAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSI
QEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPD
GLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAM
PADAPLCLRLASLIEI
Download sequence
Identical sequences A0A024R971 G3R879 K7A2A5 Q06828
ENSGGOP00000011582 ENSP00000347041 ENSP00000347041 gi|71040111|ref|NP_002014.2| ENSP00000347041 9598.ENSPTRP00000003137 9606.ENSP00000347041 ENSGGOP00000011582 NP_002014.2.87134 NP_002014.2.92137 XP_018884545.1.27298 XP_514114.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]