SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q07E27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q07E27
Domain Number 1 Region: 268-332
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000713
Family LIM domain 0.058
Further Details:      
 
Domain Number 2 Region: 328-394
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000203
Family LIM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q07E27
Sequence length 421
Comment (sp|Q07E27|TES_MUSPF) Testin KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TES; OC=Mustelinae; Mustela.
Sequence
MDLEAKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEED
RKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQ
ALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPKEVKEMEQFVK
KYKSEALGVGDVKLPREMDAQGPNRMYIPSGDRSTPAAVGAMEDKSAEHKKTQYSCYCCK
QSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKKGKLYCGRHYCDSEKPR
CAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGEIYVMVNDKPVCKPCYVKNHAVV
CQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKMM
S
Download sequence
Identical sequences G9KSY0 Q07E27
ENSMPUP00000007180 ENSMPUP00000007180 XP_004741981.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]