SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q083I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q083I9
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-18
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q083I9
Sequence length 76
Comment (tr|Q083I9|Q083I9_SHEFN) Thiol-disulfide isomerase and thioredoxins {ECO:0000313|EMBL:ABI71576.1} KW=Complete proteome; Reference proteome OX=318167 OS=Shewanella frigidimarina (strain NCIMB 400). GN=Sfri_1726 OC=Shewanellaceae; Shewanella.
Sequence
MKIIKVLGSGCKKCLETAELAQAIADEKGVAIKIEKVTDMAQIMAYDVMSTPAVVVDEKV
VHKGSKPTKDQMAMWI
Download sequence
Identical sequences Q083I9
WP_011637192.1.15765 318167.Sfri_1726 gi|114562901|ref|YP_750414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]