SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q086Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q086Z2
Domain Number 1 Region: 23-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-26
Family DsbA-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q086Z2
Sequence length 218
Comment (tr|Q086Z2|Q086Z2_SHEFN) Thiol:disulfide interchange protein {ECO:0000256|PIRNR:PIRNR001488} KW=Complete proteome; Reference proteome OX=318167 OS=Shewanella frigidimarina (strain NCIMB 400). GN=Sfri_0818 OC=Shewanellaceae; Shewanella.
Sequence
MIKYFAIVLTLITASFSTFATPFVAGKHYTQISNNMVPSEPKVTEFFSFYCHNCFNMESQ
YLPEIKAGLDKKITFDSKHVDFMNSDLGTEVMRALAVIHELDNKEALKIAMFGAIQGKDN
TGGHDHAAAGHEHKSQINNRDDIKNVFAQFGVDAKQYDTVADSADTNKKLTMWRQQQVTY
AVQSVPAFIVNDKYAINLNEMRSLDDIIGVINYLALKQ
Download sequence
Identical sequences Q086Z2
gi|114561998|ref|YP_749511.1| WP_011636296.1.15765 318167.Sfri_0818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]