SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q08BY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q08BY6
Domain Number 1 Region: 225-496
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-79
Family Protein kinases, catalytic subunit 0.000000245
Further Details:      
 
Domain Number 2 Region: 129-268
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-30
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 3 Region: 55-137
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-16
Family SH3-domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q08BY6
Sequence length 511
Comment (tr|Q08BY6|Q08BY6_DANRE) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:153964 OC=Cyprinidae; Danio.
Sequence
MGECCRKTCPCLKTIWDKIYGPPQAEGENSVKVDGDFTNKGFDKNETERRYSKPKIKPPL
PPSANNNAAIYMALWDFKARNDQELSFKAGDKFEITDRSGDWWTANKKDIFGRVTTGFVP
YNYLARDSVESQPWFFGKMNRVGAVSHLMSDENNYGSFLVRVSESDDMGYVLSVRTKENA
KHFKIFQTGDQFYVDALFKFSSIVEVIEHYQSHPLSIGDLLSEPCIRIKPENVPPPSTDE
WELPKEEFQLENQLGSGHFADVYSGKWKNHSKVAIKILKNNDALVLREFQLEVQIMKRLR
HKHLISLFAVCTSSSPFYIITELIEKGDLLHFLRNPEGRSLQMESLIDMAAQVADGMAYL
EANNSIHRDLAARNVLVGDGYVCKIADFGLARIIKEPVYLSDDKKIPYKWTAPEAIGHGT
YSSKSDVWSFGILLYEIVTHGGIPYPGVNTGEVYDLITKENYRMPSPPKCPQAIYNIMRA
CWRIESVDRPNFKVLKDELDNYQGQYSSVGN
Download sequence
Identical sequences Q08BY6
NP_001070140.1.45394 ENSDARP00000078382 7955.ENSDARP00000078382 ENSDARP00000078382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]