SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q08DJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q08DJ1
Domain Number 1 Region: 409-495
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000222
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 2 Region: 245-324
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000471
Family Ypt/Rab-GAP domain of gyp1p 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q08DJ1
Sequence length 526
Comment (tr|Q08DJ1|Q08DJ1_BOVIN) TBC1 domain family, member 19 {ECO:0000313|EMBL:AAI23720.1} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TBC1D19 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLQEESDLSLIIAQIVQKLKGSNLYAQLERQAWASLQRPEIKLESLKEDIKEFFKISGWE
KKLQNAVYSELSVFPLPSHPAAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTELSIPL
ARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLINLRNPNYESGDSLSFRT
HLGLIQVPLKVKDIPELKEFFVELGLTTGQLGIDDSTQVPPELFENEHVRIGQKVLTQQD
SAAAQQYIRQGSPTALRAELWALILNISSHPEDILYYEQLKTNVIQHDLLVDSLIYKDVK
LTASNDDYYFVFEDYLYQVLLCFSRDTSVLSHFAYNSASPPKSYIRGKLGLEEYAVFYPP
NGVIPFHGFSMYVAPLCFLYHEPSKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFET
LLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVL
AAAVFAFRAVNLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT
Download sequence
Identical sequences Q08DJ1
ENSBTAP00000044404 NP_001070406.1.59421 NP_001070406.1.76553 XP_010804342.1.76553 ENSBTAP00000044404 9913.ENSBTAP00000044404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]