SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q098Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q098Y5
Domain Number 1 Region: 221-401
Classification Level Classification E-value
Superfamily Subtilisin-like 3.8e-23
Family Subtilases 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q098Y5
Sequence length 416
Comment (tr|Q098Y5|Q098Y5_STIAD) Uncharacterized protein {ECO:0000313|EMBL:EAU68258.1} KW=Complete proteome; Reference proteome OX=378806 OS=Stigmatella aurantiaca (strain DW4/3-1). GN=STIAU_5824 OC=Cystobacterineae; Archangiaceae; Stigmatella.
Sequence
MTLKSVGNPLRPQVRTESSQGQTTRSPANAPAAPSNQALKSSFDTATAQQGPRLAQAAGG
TGPVRSFLDRAGEARSAATRTQAAGGNAIKDFLSRLNPGDDTIAIFDSFGPGTTHGDNVE
HVVDENSEYSDDDIRTVPVGSSPAPAGASLDERIEQRASSFLDSTSDAMQGILDNPGDIT
VINQSQSISPVRIADEMWQEVRNDPEAKAELAQELGLEEGASDTEILQALVDRVDGVFEN
SPEIAASKERYDRLSGELEDAGILHVVTAGNTGDFLDTLDEMGVEYDGDFADSVLFNEHT
IVVAASTGGKRDQIADFSTPSDFVTVAIDGTDIEVVGGETANGTSFAAPQVTALIAEMRR
INPDLTNDEIRDLLAKAATDTSATAQEEGHGILDPDKALMLARLSLLKDLPVLRAV
Download sequence
Identical sequences Q098Y5
gi|310824937|ref|YP_003957295.1| WP_002612137.1.13107 WP_002612137.1.14028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]