SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0E8F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0E8F0
Domain Number 1 Region: 61-435
Classification Level Classification E-value
Superfamily L domain-like 7.18e-65
Family Ngr ectodomain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0E8F0
Sequence length 780
Comment (tr|Q0E8F0|Q0E8F0_DROME) Capricious, isoform D {ECO:0000313|EMBL:ABI31251.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG11282 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRRRAITMSLAPHLGQAFSLCLCLCLCLVLATLPVALGLANCPNGCECDDDTLMVNCGE
GTLDVLPIALNPAIQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAK
LQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRIS
HIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLK
GLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDF
EVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGG
LPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRLLWLRHLLVSRNASGQYA
PVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHR
IREMLKGHSALGRKEREYQKTFSDEEYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVTEL
XLEAPPPPQLRGRGGGGGASTASGAVQQLQVPSAVDQASNSFAQLSHIHYMTNNGQQQQA
QQQQSTSKMHHSQQDMRLLACNGGKPLNATSLPRHRPPVVQESTLSHYSQPLANGIRLTQ
DHFNHNQNQSHNQHYGGVYAKPCDAMSEPGYIHNNSHYSLPLDHDLPPSPTPTPPPPALP
LRNGVGMALIHGNTTGRRSFNNNNNVSTLSNNNHHGIGGGVGVAVGGTVGNNNGSLRRYH
Download sequence
Identical sequences Q0E8F0
FBpp0293933 FBpp0075571 NP_001036604.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]