SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0EDH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0EDH7
Domain Number 1 Region: 137-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-71
Family Nuclear receptor ligand-binding domain 0.000000000634
Further Details:      
 
Domain Number 2 Region: 27-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0EDH7
Sequence length 383
Comment (tr|Q0EDH7|Q0EDH7_XENTR) Thyroid hormone receptor beta {ECO:0000313|EMBL:BAE93231.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN= OC=Silurana.
Sequence
MPSSMSETEETKPGHLGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKN
LHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIAVGMATDLVLDDSKRLAKRKLIEENREK
RRKDEIQKSLVQKPEPTQEEWELIQVVSEAHVATNAQGSHWKQKRKFLPEDIGQAPIVSA
PEGGKVDLEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAA
VRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGVSLSSFSLDDTEVALLQAVLL
MSSDRPGLTSVERIEKCQEGFLLAFEHYINYRKHNIAHFWPKLLMKVTDLRMIGACHASR
FLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences Q0EDH7
gi|113931636|ref|NP_001039270| gi|91754112|gb|BAE93231| NP_001039270.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]