SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0IAN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0IAN8
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.07e-46
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 4-55
Classification Level Classification E-value
Superfamily UBA-like 4.24e-19
Family TS-N domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0IAN8
Sequence length 218
Comment (sp|Q0IAN8|EFTS_SYNS3) Elongation factor Ts {ECO:0000255|HAMAP-Rule:MF_00050} KW=Complete proteome; Reference proteome OX=64471 OS=Synechococcus sp. (strain CC9311). GN=sync_1276; OC=Synechococcus.
Sequence
MAAVSAKLVKELRDKTGAGMMDCKKALAETSGDTTKAVEWLRQKGIASAEKKSSRAAAEG
AIGSYIHTGARVGVLLELNCETDFVARGDLFQGLLRDVSMQVAACPNVEYVSTDDIPQDI
IDREKSIEMGRDDLDGKPDQMKVKIVEGRIGKRLKEMSLLDQPFIRDSSMSVADLVKEVA
GKIGENVKVRRFTRYTLGEGIEIKQVDFATEVASMTNS
Download sequence
Identical sequences Q0IAN8
64471.sync_1276 gi|113952842|ref|YP_730484.1| WP_011619204.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]