SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0ICP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0ICP1
Domain Number 1 Region: 2-154
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.96e-34
Family N-terminal domain of MutM-like DNA repair proteins 0.00083
Further Details:      
 
Domain Number 2 Region: 150-242
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.24e-28
Family Middle domain of MutM-like DNA repair proteins 0.00057
Further Details:      
 
Domain Number 3 Region: 238-288
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.99e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0ICP1
Sequence length 290
Comment (tr|Q0ICP1|Q0ICP1_SYNS3) DNA-(apurinic or apyrimidinic site) lyase MutM {ECO:0000256|HAMAP-Rule:MF_00103} KW=Complete proteome; Reference proteome OX=64471 OS=Synechococcus sp. (strain CC9311). GN=sync_0561 OC=Synechococcus.
Sequence
MPELPEVETVRRGLANRLDQFVISDLEVCRDRAIASPGGPECFESGLLNCRVGNWMRRGK
YLYSELYRPGSAEANSAEESAGYWGVHLRMTGQFQWIEDDTPPCKHTRVRFWNAKGQELR
FVDLRSFAEMWWVPPDTAVESIITGLKKLGPEPFSQDFKTQYLQERFKGSTRSIKAALLD
QSIVAGTGNIYADESLFAAGICPQTPAGQLNRKQLEKLRECLIEILELSIGAGGTTFSDF
RDLEGVNGNYGGQAAVYRRTGQPCPKCGKAIERIKLAGRSTHWCSSCQTS
Download sequence
Identical sequences Q0ICP1
gi|113954166|ref|YP_729781.1| 64471.sync_0561 WP_011618509.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]