SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0IGY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0IGY0
Domain Number 1 Region: 154-439
Classification Level Classification E-value
Superfamily L domain-like 2.38e-50
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 464-761
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.13e-40
Family Rhodopsin-like 0.0027
Further Details:      
 
Domain Number 3 Region: 85-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0IGY0
Sequence length 806
Comment (tr|Q0IGY0|Q0IGY0_DROME) Leucine-rich repeat-containing G protein-coupled receptor 4, isoform B {ECO:0000313|EMBL:ABW09404.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG34411 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MCIAHLPITFTLAILLAIASNEGAQGVESATRTAIEAIRTGIGTKPETEIADATEAEAPV
REVISLLGIIDGAESDILVPDADDKCPGGYFHCNTTAQCVPQRANCDGSVDCDDASDEVN
CVNEVDAKYWDHLYRKQPFGRHDNLRIGECLWPNENFSCPCRGDEILCRFQQLTDIPERL
PQHDLATLDLTGNNFETIHETFFSELPDVDSLVLKFCSIREIASHAFDRLADNPLRTLYM
DDNKLPHLPEHFFPEGNQLSILILARNHLHHLKRSDFLNLQKLQELDLRGNRIGNFEAEV
FARLPNLEVLYLNENHLKRLDPDRFPRTLLNLHTLSLAYNQIEDIAANTFPFPRLRYLFL
AGNRLSHIRDETFCNLSNLQGLHLNENRIEGFDLEAFACLKNLSSLLLTGNRFQTLDSRV
LKNLTSLDYIYFSWFHLCSAAMNVRVCDPHGDGISSKLHLLDNQILRGSVWVMASIAVVG
NLLVLLGRYFYKSRSNVEHSLYLRHLAASDFLMGIYLTLIACADISFRGEYIKYEETWRH
SGVCAFAGFLSTFSCQSSTLLLTLVTWDRLMSVTRPLKPRDTEKVRIVLRLLLLWGISFG
LAAAPLLPNPYFGSHFYGNNGVCLSLHIHDPYAKGWEYSALLFILVNTLSLIFILFSYIR
MLQAIRDSGGGMRSTHSGRENVVATRFAIIVTTDCACWLPIIVVKLAALSGCEISPDLYA
WLAVLVLPVNSALNPVLYTLTTAAFKQQLRRYCHTLPSCSLVNNETRSQTQTAYESGLSV
SLAHLGGGVGGGSGRKRMSHRQMSYL
Download sequence
Identical sequences Q0IGY0
7227.FBpp0289593 FBpp0289593 NP_001096966.2.81976 FBpp0289593 FBpp0289593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]