SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0IH67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0IH67
Domain Number 1 Region: 62-145
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 7.19e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 359-416
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000811
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0IH67
Sequence length 420
Comment (tr|Q0IH67|Q0IH67_XENLA) Uncharacterized protein {ECO:0000313|EMBL:AAI23291.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN= OC=Xenopus.
Sequence
AFLSERLEVVQQVMARFNVLGSMFQVPETRAQNVSIYYSPKESFKGRLLRRKLSKSDIGS
PSNFKHLAHVGSPSGTSLDSRTDADLKRLFNLAGIKEEHLKDWEMSRKIFAVIEKKGGME
AVRKETLRIAQSEMPDQRSRSRSLSSSNLTPSKRQNSFPVACPHAAKIPVTALPSSPFSY
IASLPRVPPAPRFPPPPPPPPLFPTMSPIPSPPPLSGDFSHVPPPAQSNKISHRTNIISK
PSLTDIPTRPVIPPLPPTLPSVKDSTLVPLSLPPLPTSVHNSSSEFFVPCQPQSLASYQQ
KDMQNASVPLPPPLPLSLKKPSSENVCLTFPSCPAEDLHKSQLKCRMQTENINGEMPQRE
QSLFLDQIRQGVQLKSISQPSKMESSQNSTIVSALMEVIQKRHKALHGSDHETDDDEWED
Download sequence
Identical sequences Q0IH67
gi|114107926|gb|AAI23291|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]