SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0II40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0II40
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-40
Family Dual specificity phosphatase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0II40
Sequence length 196
Comment (tr|Q0II40|Q0II40_BOVIN) Similar to Dual specificity protein phosphatase 18 (Low molecular weight dual specificity phosphatase 20) {ECO:0000313|EMBL:AAI22820.1} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DUSP21 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTTPLCPFPIQAVRQPAAHGLSQITKSLYLSDAVAAKDKAMLSTNHITTVINVSMEATDT
FLEDIQYVKVPLADAPNSRLYDFFDFIADHIHSVEMKQGRTLLHCAAGVSRSATFCLAYL
MKYHSMSLLDAHTWTKSCRPTIRPNNGFWEQLIYYEFKLFSKNTVHMISSSMGMIPDVYE
KEICLMTLMGVIPDSS
Download sequence
Identical sequences L8ISI2 Q0II40
ENSBTAP00000002365 NP_001071485.1.59421 NP_001071485.1.76553 XP_005891410.1.15283 XP_019811191.1.53367 9913.ENSBTAP00000002365 ENSBTAP00000002365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]