SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0J0G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0J0G6
Domain Number 1 Region: 5-241,290-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.01e-64
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 501-640
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.12e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00019
Further Details:      
 
Domain Number 3 Region: 204-326,365-426
Classification Level Classification E-value
Superfamily PH domain-like 7.01e-25
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 729-829
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.54e-23
Family Ankyrin repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0J0G6
Sequence length 836
Comment (tr|Q0J0G6|Q0J0G6_ORYSJ) Os09g0510700 protein {ECO:0000313|EMBL:BAF25549.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_090510700 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MFFTRLDDSPMFRKQIQSLEEGSELLRERCLRFHKGCRKYTEGLGEAYDGDIAFASSLEA
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVENMLNDKLLQFVDIDLHDVKD
ARKRFDKASLLYDQARERYLSLKKGTRTDVATAVEDELHSARSSFEQARFNLVTALSNIE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLAYAQQSRERSNYEQAALVER
MQEFKRQIDRESRWSPNGINDSPNGDGIQAIGRSSHKMIEAVMQSASKGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQNSRPSSGYTNQRSSAPSEHGSGLLSRWFSSH
YHGGVHDEKSVARHTVNLLTSTIKADADQSDLRFCFRIISPTKNYTLQAESAMDQMDWIE
KITGVIASLLSSQSPERRLLSSPKGSGHNRTASESSSFSSSTELDHSISEDCMLERNSGS
GYFDHSGRAIQHHRTSMKPDKPIDLLRKVVGNNICADCGAAEPDWASLNLGILLCIECSG
VHRNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNTFANTIWEDMLPSSSSVDHGDNSRA
DGLENTSHNLIFSKPKHSDHIAVKEKFIHAKYAERDYVRKLNMDDSLVAQQMWENVSSNN
KKGVYSLIVGSNADVNLTYGQTSFNSALTLGKALLLQEQPTSPSDGSSRCFDRSSLERIS
PRDSLSLASTSARIDELDDCVEGLSLLHLACRVADVGMVELLLQYGANVNSADSRGRTPL
HHSILKGRHMFAKLLLSRGADSQATDRDGRTALQYAIDSGTIDDEEILVLLEDPSR
Download sequence
Identical sequences A0A0D3H8S1 Q0J0G6
39947.LOC_Os09g33600.1 LOC_Os09g33600.1|13109.m03344|protein LOC_Os09g33600.1|PACid:21927013 OBART09G16000.1 XP_015612554.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]