SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0JLN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0JLN8
Domain Number - Region: 245-282
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00942
Family Formin homology 2 domain (FH2 domain) 0.036
Further Details:      
 
Domain Number - Region: 564-652
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0209
Family FCH domain 0.079
Further Details:      
 
Domain Number - Region: 371-414
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0837
Family Troponin T 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0JLN8
Sequence length 685
Comment (tr|Q0JLN8|Q0JLN8_ORYSJ) cDNA clone:J013001B11, full insert sequence {ECO:0000313|EMBL:BAG89301.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_010585600 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGCTHSKVEDEEAVRRCKDRRKLMKQLMRRRVELAAAQTAYLQSLRNTGATLRQFAEVES
ALSQQPPAGIAVHPSPPPPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRPPPPL
PFSPIVIRRKKRDGELDEDDSTDDDDDTDSCSTPLPPPPPPGVEWEYLEPFAMRPLNFPS
SLADRIDKEAASQVTMDDDNWVETNTEFDGYDDESVSGNVEGIVSSVQLNQAKSRALGDD
NSSMVSWVTKDSDTSAMAWRSKKSLAGIAKEIDEYFLKAAASGSDIVILLDSSGGQPDPS
ELEANRGKNSKSAKVFSTISWSWSFKSAQANRQSSMHSSDASGYGYHGKTLEKLYEEEQK
LYKLVKDEEFARLQYRKNTSLLQRLESGDHDKLHAEKVRDNIEELQARIISLEEAVGLTC
LSISKLRDEELYPQIIELSAGLVHMWRNMYECHQVQNHIAQQANLLGNLPGNEPTTDTHC
QATSQLEVEVSAWHSSFCNLITLQRDYVTILNQWIKLTDCLPDNDGFMKSSSGIRSLCAE
LQRALTGLPEKVAAEAIKTFLSVIHTIVVQQTEERQLKKKSDQIESKFHTQLEKHSNNAT
QNSGQPTLAKLDTFKKQVEEEKARYLNSVRTSRAMTLNNLQTSLPNVFHALMGFSGVCVQ
AFEGISRCSEIVASHSGAVSPAISS
Download sequence
Identical sequences Q0JLN8
LOC_Os01g40330.1|PACid:21905870 39947.LOC_Os01g40330.1 XP_015619313.1.37577 LOC_Os01g40330.1|13101.m04126|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]