SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0RCM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0RCM9
Domain Number 1 Region: 83-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.75e-30
Family GntR ligand-binding domain-like 0.0037
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-20
Family GntR-like transcriptional regulators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0RCM9
Sequence length 230
Comment (tr|Q0RCM9|Q0RCM9_FRAAA) Putative GntR-family transcription regulator {ECO:0000313|EMBL:CAJ64795.1} KW=Complete proteome; Reference proteome OX=326424 OS=Frankia alni (strain ACN14a). GN=FRAAL6172 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MVNSMKTLGAAHRPLRELVADELRQRILDGRITQGSRVIEDRLAEELGVSRNPVREAIRA
LESEGLVEVTPRRGVVVTVISAEEAHDLIEVRAALEVTAVRRAAARGVDPAVLAELAEIV
ATGSEAAAAGEFERLPMLNTRFHDLLARGSGNGALVEVLRDLQNRLQLLFSTGVQRRSGG
AWDEHRRILDAIRAGDADWAEAEMRSHIRGAASRYEDTRAGVAAATGGAA
Download sequence
Identical sequences Q0RCM9
WP_011607222.1.38265 326424.FRAAL6172 gi|111225516|ref|YP_716310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]