SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0SVC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0SVC2
Domain Number - Region: 66-121
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0333
Family Galectin (animal S-lectin) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0SVC2
Sequence length 179
Comment (tr|Q0SVC2|Q0SVC2_CLOPS) Uncharacterized protein {ECO:0000313|EMBL:ABG87006.1} KW=Complete proteome OX=289380 OS=Clostridium perfringens (strain SM101 / Type A). GN=CPR_0601 OC=Clostridium.
Sequence
MIIRLIVCILILGGLIIYRNNKLKTINLEKKKTDSKVISLLYDKLSNVLLIFFAFDMVIG
AMARDANNMTSNIWGVLTIIFCFGVFIYVTKESFKSTIIIRKNDFILFVNGEENINFHDV
KEINISNTVNKYVYLITIFLNDGREYRIKGRDQYEMNKVVRLINERIGYKALKEELAKA
Download sequence
Identical sequences Q0SVC2
289380.CPR_0601 gi|110803135|ref|YP_697928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]