SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0SWK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0SWK1
Domain Number 1 Region: 989-1101
Classification Level Classification E-value
Superfamily Collagen-binding domain 9.94e-29
Family Collagen-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 863-975
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.22e-28
Family Collagen-binding domain 0.00018
Further Details:      
 
Domain Number 3 Region: 773-858
Classification Level Classification E-value
Superfamily PKD domain 4.97e-17
Family PKD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0SWK1
Sequence length 1104
Comment (tr|Q0SWK1|Q0SWK1_CLOPS) Microbial collagenase {ECO:0000313|EMBL:ABG87113.1} KW=Complete proteome OX=289380 OS=Clostridium perfringens (strain SM101 / Type A). GN=CPR_0162 OC=Clostridium.
Sequence
MKKNLKRGELTKLKLVERWSATFTLAAFILFNSSFKVFAADKKIENSNNGQITREINADQ
ISKTELNNEVATDNNRPLGPSIAPSRARNNKIYTFDELNRMNYSDLVELIKTISCENVPD
LFNFNDGSYTFFSNRDRVQAIIYGLEDSGRTYTADDDKGIPTLVEFLRAGYYLGFYNKQL
SYLNTPQLKNECLPAMKAIQYNSNFRLGTKAQDGVVEALGRLIGNASADPEVINNCIYVL
SDFKDNIDKYGSNYSKGNAVFNLMKGIDYYTNLVIYNTKGYDAKNTEFYNRIDPYMERLE
SLCTIGDKLNNDNAWFVNNALYYTGRMGKFREDPSISQRALERAMKEYPYLSYQYIEAAN
DLDLNFGGKNSSGNDIDFNKIKADAREKYLPKTYTFDDGKFVVKAGDKVTEEKIKRLYWA
SKEVKAQFMRVVQNDKALEEGNPDDILTVVIYNSPEEYKLNRIINGFSTDNGGIYIENIG
TFFTYERTPEESIYTLEELFRHEFTHYLQGRYVVPGMWGQGEFYQEGVLTWYEEGTAEFF
AGSTRTDGIKPRKSVTQGLAYDRNNRMSLYDVLHAKYGSWDFYNYGFALSNYMYNNNIGM
FNKMTNYIKNNDVSGYKDYIASMSSDYGLNDKYQDYIDSLLNNIDNLDVPSVSDEYVNGH
EAKDINEITKDIKEVSNIKDLSSNVEKSQFFTTYDMRGTYVGGRSQGEENDWKDMNSKLN
DILKELSKKSWNGYKTVTAYFVNHKVDENGNYVYDVVFHGMNTDTNTDVHVNKEPKAVIK
SDSSVIVEEEINFDGTESKDEDGEIKAYEWDFGDGEKSNEAKAAHKYNKTGEYEVKLTVT
DNNGGINTESKKIKVVEDKPVEVINESEPNNDLEKANQITKSNMLVKGTLSQNDYSDKYY
FDVAKKGNVKITLNNLNSVGITWTLYKEGDLNNYVLYATRNDGTELKGEKILEPGRYYLS
VYTYDNQSGAYTVNVKGNLKNEVKEVEKDSIKEVENNNDFDKAMKVDSNSKIVGTLSNDD
LKDIYSIDIQNPSDLNIVVENLDNIKMNWLLYSADDLSNYVYYANADGNKLSNTCKLNPG
KYYLCVYQFENSGTGNYTVNLQNK
Download sequence
Identical sequences Q0SWK1
289380.CPR_0162 gi|110803242|ref|YP_697499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]