SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0V9F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0V9F3
Domain Number 1 Region: 115-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000142
Family Cripto EGF-like domain-like 0.0092
Further Details:      
 
Domain Number 2 Region: 79-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000328
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0V9F3
Sequence length 190
Comment (tr|Q0V9F3|Q0V9F3_XENTR) Cripto, FRL-1, cryptic family 1 {ECO:0000313|EMBL:AAI21595.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=cfc1 OC=Silurana.
Sequence
MQLLRFLAILVFSAKYFIKHCKGESCVGLYCNDTGLSLAIKSNTIHQILQDTINATHGKS
PEKSAKTLPFLGITDSKKLNKKCCQNGGTCFLGTFCICPKQFTGRHCEHERRPASCAGVP
HGDWIRQGCLLCRCVSGVLHCFTPESEDCGPVHEKNMRSGVPRTQLSLFIYYLFIANLFY
HIVWHLNIGL
Download sequence
Identical sequences Q0V9F3
gi|111306179|gb|AAI21595| gi|118404164|ref|NP_001072395| gi|163916003|gb|AAI57156| NP_001072395.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]