SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0V9R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0V9R8
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-71
Family Kelch motif 0.0000342
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.37e-35
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0V9R8
Sequence length 600
Comment (tr|Q0V9R8|Q0V9R8_XENTR) Kelch-like family member 24 {ECO:0000313|Ensembl:ENSXETP00000030304} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=klhl24 OC=Silurana.
Sequence
MVLILGRRMNREEGGVRESPATKRKVFEMDQKQLTGHEVFDFNSGSSHSESILQVFNEFR
ENRLFTDVIICVEGREFPCHRAILSACSSYFRAMFCNDHRESREMLVEINGIFAEAMDCF
LQYVYTGRVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQHFADTHSL
KTLFTKCKSFAQQAFEDVVQHEEFLELGKAELIDYVSTDELVVSKEELVFEAVMRWVYHH
VDVRRPMLQELLTHVRLPLLHPNYFVQTVEVDQIIQNAPDCYQLLHEARRYHILGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNR
LSSVESYDSFSNRWTDVAPLKEAVSSPAVASCVGKLFVVGGGPDDNTCSDKVQCYDPDNN
TWLLRASIPIAKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWIHVQNTFTRQENCGMS
VCNGKIFILGGRGENGEATDTILCYDPATSIITGVAAMPRPVSYHGCVTIHRFNEKAFKM
Download sequence
Identical sequences Q0V9R8
ENSXETP00000030304 ENSXETP00000030304 gi|111308087|gb|AAI21420| gi|118403467|ref|NP_001072337| gi|169642150|gb|AAI60560| NP_001072337.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]