SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0VC30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0VC30
Domain Number 1 Region: 67-355
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-113
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000014
Further Details:      
 
Domain Number 2 Region: 369-481
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.85e-27
Family Anticodon-binding domain of Class II aaRS 0.000000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0VC30
Sequence length 485
Comment (sp|Q0VC30|DPOG2_BOVIN) PolG-beta KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=POLG2; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MRSAPAIRACQRICRCLLSGFGGQVDGRQPEQLSKGTGSFVGPVRSQAELPRNEPREAPE
SGGEGSEPLVEICRKRRFLSGTKQQLSRDSLLNGCHPGLGPLGIELRKNLAAEWWSSVVV
FREQVFPVDALHREPGPSLPVDNGFRLVSAETLREILQDKELSKEQLVAFLENLLNTSGK
LRENLLHGALEHYVSYLDLVNKRLPFGLAQIGACFHPVSDTKQTPDGVKRIGEKTEASLV
WFTSARTASQWLDFWLRHRLLWWRKFAMSPSNFSSGDCQDEAGRKGNRLYYNFPWGKEPI
ETLWNLGDHELLHMYPGSVAQVHGRDGRKNVVPSVLSINGDLDRGMLAYLYDSFQLTENS
FTRKKDLHRKVLKLHPCLAPIKAALDVGRGPTVELRQVCQGLFNELLENGISVWPGYLET
VQSSLEQLYSKYDEMSILFTVLITEATLENGLIQLRSRDTTMKEMMHISKVKDFLTKYIS
SAKNV
Download sequence
Identical sequences Q0VC30
NP_001068659.1.59421 NP_001068659.1.76553 9913.ENSBTAP00000024509 ENSBTAP00000024509 ENSBTAP00000024509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]