SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0VDF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0VDF9
Domain Number 1 Region: 189-380
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.62e-47
Family Actin/HSP70 0.0000196
Further Details:      
 
Domain Number 2 Region: 2-183
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.24e-46
Family Actin/HSP70 0.0000237
Further Details:      
 
Domain Number 3 Region: 386-507
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000000000000157
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0VDF9
Sequence length 509
Comment (sp|Q0VDF9|HSP7E_HUMAN) Heat shock protein HSP60 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HSPA14; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNI
SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI
FSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAY
GIGQDSPTGKSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLA
SEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARF
ELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNS
IPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVL
TMKRDGSLHVTCTDQETGKCEAISIEIAS
Download sequence
Identical sequences Q0VDF9
gi|82880658|ref|NP_057383.2| ENSP00000367623 ENSP00000309384 ENSP00000367623 9606.ENSP00000367623 APC89504 NP_057383.2.87134 NP_057383.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]