SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0VNR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0VNR5
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.93e-39
Family SMI1/KNR4-like 0.00000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0VNR5
Sequence length 135
Comment (tr|Q0VNR5|Q0VNR5_ALCBS) Uncharacterized protein {ECO:0000313|EMBL:CAL17183.1} KW=Complete proteome; Reference proteome OX=393595 OS=/ SK2). GN=ABO_1735 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MDDIVDMLRERHDGGLIALELPDEDRLVEIEEQLLISLPADYKAFLLSASDIVCGSLEPA
TVMDDYAHNFLPEMAANSWNQGLPRYLIPVCETPNGIYAMSQEGEVVLWQPEQGINEDEV
WGSIWQWAREVWLES
Download sequence
Identical sequences Q0VNR5
393595.ABO_1735 gi|110834596|ref|YP_693455.1| WP_011589016.1.14994 WP_011589016.1.41240 WP_011589016.1.66393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]