SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0W8M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0W8M7
Domain Number 1 Region: 98-167
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00045
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0W8M7
Sequence length 181
Comment (tr|Q0W8M7|Q0W8M7_METAR) Uncharacterized protein {ECO:0000313|EMBL:CAJ35266.1} KW=Complete proteome; Reference proteome OX=351160 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50). GN=LRC289 OC=Methanocellaceae; Methanocella.
Sequence
MQEHIKVPQDRIGAIIGVDGKIKELLEKKSGAQISVDSESGTVVIDSKEGDPFKALKASD
AIKAIARGFSPEKALKLLDSEDLILDMMDLSKITDTPSDLTRIKGRIIGRGGKTREIIES
MTGAKISVYGKTISIIGDAEQIMTVRTALDMLIDGAPHGAVYGYLERRRREIKQSQFESI
Q
Download sequence
Identical sequences Q0W8M7 Q5NW02
gi|147921591|ref|YP_684592.1| WP_012037224.1.28485 351160.LRC289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]