SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0WPD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0WPD9
Domain Number 1 Region: 37-281
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.63e-20
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0WPD9
Sequence length 312
Comment (tr|Q0WPD9|Q0WPD9_ARATH) Alpha/beta-Hydrolases superfamily protein {ECO:0000313|EMBL:AEE75073.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g11620 OC=Arabidopsis.
Sequence
METQNKLMNETKRHVKSRLCRVSGSMTEMMEIQAENPTFHVLFIPGNPGVVSFYKDFLES
LYEFLGGNASVIAIGQISHTSKDWESGRLFSFQEQIDHKIDFIRQELESVKVPIILVGHS
IGSYISLELLKKFSDKVVYCIGLYPFLTLNQQSTKQSLIGKLAASSVLSATASFLIASLR
LLPMSAARLLVSKSIGASWSDTAVQATCTHLRQYHTMRNVLFMAKSEFRELAAEPDWDFM
RENQSKLAFLFGIDDHWGPLQLFEEISKQAPHTSLSIEREGHTHGFCCTVAGSAWVAQHV
ATLIKNRFSQLQ
Download sequence
Identical sequences A0A178V8W4 Q0WPD9
AT3G11620.1 AT3G11620.1 AT3G11620.2 3702.AT3G11620.1-P NP_001327052.1.80155 NP_566394.1.80155 NP_850560.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]