SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0ZL68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0ZL68
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-23
Family Duffy binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0ZL68
Sequence length 121
Comment (tr|Q0ZL68|Q0ZL68_PLAFA) EMP1 variant U1f {ECO:0000313|EMBL:ABC95933.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIGDIIRGKDMKQFNRKKNQKQTEREKLEEKLQSFFKNIHDKLDDSIKSNYNNDTTDYYQ
LREDWWDANRLDVWKAITCDAPEKAEYFRKACSEGTSPTHKQCRCVTDVPTYFDYVPQFL
R
Download sequence
Identical sequences Q0ZL68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]