SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10M30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10M30
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily Homeodomain-like 6.45e-18
Family GARP response regulators 0.0025
Further Details:      
 
Weak hits

Sequence:  Q10M30
Domain Number - Region: 140-206
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0555
Family IMD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q10M30
Sequence length 354
Comment (tr|Q10M30|Q10M30_ORYSJ) Transfactor, putative, expressed {ECO:0000313|EMBL:ABF95708.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_10679 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MYHHQQQLQSHNQLLPSRQSFPSERHLLMQGGSVSGESGLVLSTDAKPRLKWTPELHERF
VEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHAQANAGNVKNALVC
TTATEKPSEANGSPVSHLNLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQLRIEA
QGKYLQSVLEKAQETLAKQNAGSVGLETAKMELSELVSKVSTECLQHAFSGFEIESSQML
QGHTMHLGDGSVDSCLTACDGSQKDQDILSISLSAQKGKEIGCMSFDMHVKERGSEDLFL
DKLNRRPSNHPERCERRGGFSMSCQTANLDLNMNDTYDGPKHCKKFDLNGFSWA
Download sequence
Identical sequences Q10M30
LOC_Os03g20900.1|13103.m02504|protein 39947.LOC_Os03g20900.1 XP_015627784.1.37577 LOC_Os03g20900.1|PACid:21912206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]