SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10Q51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10Q51
Domain Number 1 Region: 208-403
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 40-158
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  Q10Q51
Domain Number - Region: 549-620
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00523
Family Myosin rod fragments 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q10Q51
Sequence length 860
Comment (tr|Q10Q51|Q10Q51_ORYSJ) cDNA clone:J023113J17, full insert sequence {ECO:0000313|EMBL:BAG94715.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_030209800 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSASEFRIPYQQVSSSQTAENAGQYKICRCGEGDPNTSETGDSSPTSCPNCQVLKSGHLL
LSSKGIGWTTWKKRWFILTRASLVFFRSDPNAPVRGNEPVVTLGGIDLNNTGSVVVKEDR
KLLTVLFPDSRDGRTFTLKAETTEELNEWKSALENALAQAPAVANAVGQNPIFSTDIAEP
AEAPAEQPDDKSVIGRPAEFALVDADGSPSFLEKALKFIEDYGVKVEGILRQSADVEEVK
RRVQDYEKGKNEFSPEEDAHVIGDCIKYVLREMPSSPVPAPCCTALVGAYRTDKTKRLDA
MSKVIYEVFPEPNQQLLQRILKMMQIVGSHKAVNRMSPSALAACMAPLLLRPLLLGECEI
DSDFSMAGDGSFQLLQAAAAANHAQAIVIIMLEEYDEIFDDLEDGSCSSDAYTDSEDGDV
DKEYSTDNDVDGSYDSGEDNIEEDMEDDTEYSSGGSECDDKVKRNNSGKASNVENTSQME
SNDPSHRKLHESNGSTDQIEKSNVRASSSRAKFMEKSSSRNKSKKTLLGRASARRDLSAD
ETDFCSDDETLIEKLENNKTDLQSKITKEVKENSILQASLGRRKEELHERRLALEKEVEN
LRDQLQKERKLRASLESGLMNLRRGQVSFPSTIDSKTKADLEEVATAEADILNLKQKVSD
LRGQLNNNVQMSSTSLCDSCNKRLLSTDKLFEDEQNTSPSNVGPNSMSDMASATDMADIE
QSRKQTTQHSSSSIDKPTLHKHQKSIASNEQSSTISQRAQRILSSKGGIMKDGQDGSFTS
KWNLAQKQYSNNPLLGRLGSNAYSSTRTEESGAVPFALAKLTNRLNFLKERRAILASEMQ
NLNLARPPGPTAPAPKKDST
Download sequence
Identical sequences Q10Q51
XP_015629228.1.37577 39947.LOC_Os03g11140.1 LOC_Os03g11140.1|PACid:21912007 LOC_Os03g11140.2|PACid:21912008 LOC_Os03g11140.3|PACid:21912009 LOC_Os03g11140.1|13103.m01253|protein LOC_Os03g11140.2|13103.m01254|protein LOC_Os03g11140.3|13103.m01256|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]