SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10UU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10UU3
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.8e-65
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000498
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.93e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q10UU3
Sequence length 327
Comment (tr|Q10UU3|Q10UU3_TRIEI) Transketolase, central region {ECO:0000313|EMBL:ABG53981.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_5078 OC=Microcoleaceae; Trichodesmium.
Sequence
MAQTLLFNALRAAIDEEMAHDPTVYVLGEDVGHYGGSYKVTKGLYEKYGELRILDTPIAE
NSFTGMAIGSALTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPLVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTPYNAKGLLKSAIRDENPVLFFEHVLLYNLK
EDLPEDEYLLPLDKAEVVQTGKDVTILTYSRMRHHVTQAVQTLKKQGYDPEVIDLISLKP
LDFETIGASIKKTHRVIIVEECMKTGGIAAELIASINEKLFDELDAPILRLSSQDIPTPY
NGLLERLTIVQPEQIVEAVQKMVAIKV
Download sequence
Identical sequences Q10UU3
gi|113478393|ref|YP_724454.1| WP_011614274.1.43450 203124.Tery_5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]