SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10W26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10W26
Domain Number 1 Region: 799-978
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.88e-24
Family Peptidoglycan hydrolase LytM 0.0029
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-17
Family Collagen-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 628-713
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000379
Family Collagen-binding domain 0.0053
Further Details:      
 
Domain Number 4 Region: 744-831
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000981
Family Collagen-binding domain 0.0085
Further Details:      
 
Weak hits

Sequence:  Q10W26
Domain Number - Region: 441-610
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00544
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q10W26
Sequence length 995
Comment (tr|Q10W26|Q10W26_TRIEI) Peptidase M23B {ECO:0000313|EMBL:ABG53548.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_4572 OC=Microcoleaceae; Trichodesmium.
Sequence
MSDILGDFSNFEQDLSNLILIGDKQENFDDGQRWTSGIEPTGNNSKLKVEEFNTGGDEPS
QPLQGQKFFDLGELNHLSASNSPPGKKDPLVGEDNEAVVKKSDNLINPNPINRRSGNSRN
RADNIGTLSSSSSFTGFVGTTDTNDYYRFYLSGEREFNLTLNGLSGDADVRLLNSSGGTI
SSSTKGGSSSESISETLNSGTYYIRVYPMSGVNTNYNLNIEATSSSSDEEVNITSPSSRT
SIEPGERYNIRWTDNFRDNVKLELYKGSSRQQTIARSTSSDGSYSWRAPTSLSSGTNYRI
KIRNVNDSSVYDYSSYFTIEPDEPDGVVNITSPSSSTSIEPGERYNIRWTDNFRDNVKLE
LYKGSSRQQTIARSTSSDGSYSWRAPTSLSSGTNYRIKIRNVNDSSVYDYSSYFTIEPDE
PDEKVNITSPSSSTSIEPGERYNIRWTDNFRDNVKLELYKGSSRQRTIARSTSSDGSYSW
RAPTSLSSGTNYRIKIRNVNDSSVYDYSSYFTIKPDEEVNITSPSSSTSIEPGESYTIRW
TDNFSDNVKLDLYKGSSWQQTIASSTSSDGSYSWRVPTSLSSGTNYNIKIRNVNDSSVDD
YSNSFTIQSTTWPPSVTKDLKTYTGREEYSGYVGNDDYYKFSVDSPGYLQFALRGMSADA
NLQLLNSSGKVLESSSKSGNSDEYANENLGIGTYYMRVYGHNGADTNYRLVLNLDKAKND
RSNARWLGELAGQRKEYKDFIGTSSGDQYDYYKFTVQEPRFLEYALRDLTAPADIDILNS
SGARITPKENDKDNHRYNLHETMGLQAGTYYARVTAPTDSSQQTNYKLVLNLKGEYKPLH
SNPTESNPLKGFQSPVRGERWYVSQSPGGSYSHTGNLRYAIDISIPGWDDFGEPIYAMRS
GTVKKVVDDHPDIADSKRNNLVEIQHENGYVARYWHLQQYSNSDAGLQVGQKVDAGQMIG
RVGNSGFSTGPHLHVDVVDSSLITRPFEIEGIFDY
Download sequence
Identical sequences Q10W26
gi|113477960|ref|YP_724021.1| 203124.Tery_4572 WP_011613865.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]