SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10WS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10WS6
Domain Number 1 Region: 500-691
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.53e-32
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.046
Further Details:      
 
Domain Number 2 Region: 124-231
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.27e-17
Family Collagen-binding domain 0.0031
Further Details:      
 
Domain Number 3 Region: 240-348
Classification Level Classification E-value
Superfamily Collagen-binding domain 5.36e-17
Family Collagen-binding domain 0.003
Further Details:      
 
Domain Number 4 Region: 11-116
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.22e-16
Family Collagen-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q10WS6
Sequence length 1289
Comment (tr|Q10WS6|Q10WS6_TRIEI) Peptidase-like {ECO:0000313|EMBL:ABG53298.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_4303 OC=Microcoleaceae; Trichodesmium.
Sequence
MNNRYNKPDQVDNSRKKAYQVGALQNDEKFEDFVGKSDKRDFYQFKVEEKTDVDIKLDDL
SGNANLYLLNNKGKLIEKSTKGGKNAEDIERTLNPGAYYVKVQSNEEDANYTLSLDVGSG
SQQEDKVGNNRKKAYKFGALKNDEKFEDFVGKSDQRDFYQFKVEEKTDVDIKLGGLSGNA
DLYLLNNKGKLIEKSTKGGDSLENIERTLNPGAYYVKVQSNEEDADYTLSLGVGSGSQQE
DKVGNNRKKAYKFGALKNNEQFEEFVGKSDKRDFYRFKVEEKTDVDIELGGLGGNADLYL
LNNKGRLIEKSTKGLNKVEDIERTLNPGTYYVKVQSNDEDAKYTLSLDVGSGSKNLEKYE
FTYYYSGSQDNEFQDYYSGYFYAPKGTYEVDSYYDFNEEKNEASANGKYYISSSSKAGAK
AKDGEVYLESYYDLETKKEYVPYYASEDLPSGASGMGSEEDFIDFEKDEDVIELKQEGFF
GADYSLANIVKEAQTSKSGDYQIDALLSPYKWGTNTITYSFYDNDSGPYYGAERDVGEVS
DKVQEDIRHILENIYEPLSDLDFVEVADTSNSYGLIRIMKSSNPNYAYAYYPYADDYNAG
NLLDLAGDVHFNVYYDGNGDHNNFQGGPGTHGYMTLIHELGHAVGLKHPHEDGDTLPENE
DNTSNTVMSYNFTYTADNLRSYDVNALQYIYGFETPEDSVTVKSPNGGDTLKLGKSYTIT
WDDNFSENVKLELYKGGSFDSIITNSTASDGSYGWTLPTSMAIGSDYKVKITSVSDAGVS
DLSDSNFTIERDGVITVKSPNGGDVINTGDTYDVTWDDNISENVRIYLYQGNRYKQMISN
STPSDGSYSWTVPTSLTAGDNYEVAIQSVEKGSLYDYSDSSFTIEPDGVITVKSPNGGDV
INTGDTYNITWDDNISENVRIDLYQDNRYKQMISNSTSSDGSFRWRVPTNLATGDNYQVA
IQSVEKDRIFDFSDSNFTIEPDGVITVKSPNGGDVINTGDTYNITWDDNISENVRIYLFQ
GNRYKQMISNSTPSDGSYSWTVPTSLTAGDNYEVAIQSVEKGSIYDYSDSSFTIEPDDFI
TVMSPNGGDILNTGDTYNITWDDNIGENVRIYLFQGNRYKQMISNSTPSDGSYSWKVPTN
LTTGGNYQVAIQSVEKGSLYDFSNSNFSIKTEDVSSDKYYFTYYYNVGDSYSGFLYEKSG
TYSSDDILSVTSGFYQIDDIESGVGNKDDIGDVYISSYYDSNYTGNTYQPLLSRYGWRSG
GNGLGSERDYLGFPSYQSFDSNNEFNGLI
Download sequence
Identical sequences Q10WS6
gi|113477710|ref|YP_723771.1| 203124.Tery_4303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]