SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10XC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10XC0
Domain Number 1 Region: 10-330
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q10XC0
Sequence length 405
Comment (tr|Q10XC0|Q10XC0_TRIEI) FAD-dependent pyridine nucleotide-disulphide oxidoreductase {ECO:0000313|EMBL:ABG53104.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_4096 OC=Microcoleaceae; Trichodesmium.
Sequence
METGEIPQGEKPSNKITKICILGSGFGGLYTALYLNSFWGFKHKNCEVILIDQHDHLVFT
PLLYEVITDELQTWEIAPSFAKLLQNKKILFCQDTIQNIDFKARKVKLLEQGSLAYDYLV
ITVGVTNGKLPTTAENVLTFRTLADAQILEKKLQTLENSNQELIRVSIVGGGPSGVELAG
KIADRLGRRGEIRLIERGKEILKNFTPATRKNAQRALDKRNVLISLETTVDTIEVDKITL
WQSNESVIILTDLVLWTAGTQVREWVKNLNCYHNSRGQLICEQTLQLVGYSEVFALGDIA
EILYPNGKKLPATAQVAYQQASQAAKNLWAILNNKRPKPFRYLHLGEMITLGVNSAAVSS
FGISLHGWLAALVRLSVYLQRLPTFSHGFQVLCNRLKIWLAKRKR
Download sequence
Identical sequences Q10XC0
gi|113477516|ref|YP_723577.1| WP_011613434.1.43450 203124.Tery_4096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]