SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10XS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10XS2
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.35e-54
Family Tryptophan biosynthesis enzymes 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q10XS2
Sequence length 230
Comment (sp|Q10XS2|TRPF_TRIEI) N-(5'-phosphoribosyl)anthranilate isomerase {ECO:0000255|HAMAP-Rule:MF_00135} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_3920; OC=Microcoleaceae; Trichodesmium.
Sequence
MRIKICGITKLDQGQAIAEIGATALGFICVPKSPRYITPENIKNIIQKLPINIDKIGVFV
NPKIDLLSEIITNTQLNGIQLHGDESPEFCNQLRHSIPNNIEIIKALRIKSPQDLKKANI
YENYIDTLLLDAYHPEKLGGTGKTLDWKIIEEFHPTSPWLLAGGLTPENVTKAIQKFILV
SQTQIESNHKFNHNFCGIDLSSGVETAPGDKNLVKVRKLFSSLATLTMKK
Download sequence
Identical sequences Q10XS2
WP_011613282.1.43450 gi|113477364|ref|YP_723425.1| 203124.Tery_3920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]