SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q10Y46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10Y46
Domain Number 1 Region: 3-285
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.94e-57
Family Carbon-carbon bond hydrolase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q10Y46
Sequence length 293
Comment (tr|Q10Y46|Q10Y46_TRIEI) Alpha/beta hydrolase fold {ECO:0000313|EMBL:ABG52828.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_3781 OC=Microcoleaceae; Trichodesmium.
Sequence
MMTTKSWTWRSWPICYQSQGEEGPPVILIHGFGASLGHWRKNIPVLAASCRCYAIDLLGF
GGSAKPTPNQDVTYTFETWSQQISDFCREIVGAPAFLVGNSIGCIVAMQTAVDHPNIVLG
VGIINCSLRLLHERKRSNLPWYRSQGASLLQNLLKVKWISQLFFNQLATKKTVKRVLLQA
YKRSEAVTDELIDLLLKPAKDEGAVDIFVAFTGYSQGPLPEDLLPILPCSAIILWGEEDP
WENIELGKEFANFKNVEKFIPLPGVGHCPQDEAPELVNPILQEWILEKWESKV
Download sequence
Identical sequences Q10Y46
gi|113477240|ref|YP_723301.1| 203124.Tery_3781 WP_011613158.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]