SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q110A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q110A5
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000914
Family 7-Fe ferredoxin 0.096
Further Details:      
 
Weak hits

Sequence:  Q110A5
Domain Number - Region: 155-296
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00688
Family D-ribulose-5-phosphate 3-epimerase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q110A5
Sequence length 405
Comment (tr|Q110A5|Q110A5_TRIEI) 4Fe-4S ferredoxin, iron-sulfur binding {ECO:0000313|EMBL:ABG52169.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_3014 OC=Microcoleaceae; Trichodesmium.
Sequence
MRERYYPLNSLKEGHWFKLICGASFQHLPTVRNLTLAYTLAGADCIDVAADPAAIAATKE
AVEVASQLKSWAKNHKFGYQARPLIMASINDGEDPHFRKAEFDSTICPIECWRPCEKVCP
AEAIVFFEKDNAINLGNSGVIDELCYGCGRCLSVCPNQLIQARSYVSTPSSIASLILQTG
VDAIEIHTQVGRETDFQRLWKSIKPWVNQLKLIAISCQDDEGLIEYLQSLYKIISPLPCS
LIWQTDGKPMSGDIGVGTTAATIKLSQKVLDAGLPGYVQLAGGTNNSTVVKLIALGLLAN
KSLKQDKDYINNFNIPISENKFVAGVAYGSYARILLSPILEKLEKMHKSQLEAIEFAYDT
ASVNTKDVNQNQSKKSQLTKLETIPEILWEAVSLANSLVSQIKRL
Download sequence
Identical sequences Q110A5
WP_011612524.1.43450 gi|113476581|ref|YP_722642.1| 203124.Tery_3014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]