SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q110B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q110B3
Domain Number 1 Region: 110-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.07e-36
Family Ribosomal protein S3 C-terminal domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.14e-35
Family Prokaryotic type KH domain (KH-domain type II) 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q110B3
Sequence length 242
Comment (sp|Q110B3|RS3_TRIEI) 30S ribosomal protein S3 {ECO:0000255|HAMAP-Rule:MF_01309} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_3006; OC=Microcoleaceae; Trichodesmium.
Sequence
MGQKIHPTGFRLGITQEHRSRWYADPKNYPDTLQEDHKIRQYVKATLANAGISQIRVERK
AEQIDLEVRTARPGVVVGRGGAGIDSLRVGLQKLLGSNRQIRINVVEVTKVDTDAMLIGE
YIAQQLEKRVSFRRVVRQAITRAQKAGVEGIKIQVSGRVNGAEIARTEVTREGSVPLHTL
RANIDYAYCTAKTIYGILGIKIWVFKGEIIPGQEEIANAKVNQPKRRQQKRRQQYDDRSN
EG
Download sequence
Identical sequences Q110B3
gi|113476573|ref|YP_722634.1| 203124.Tery_3006 WP_011612516.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]