SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q110G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q110G6
Domain Number 1 Region: 10-294
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.49e-60
Family Carbon-carbon bond hydrolase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q110G6
Sequence length 300
Comment (tr|Q110G6|Q110G6_TRIEI) Alpha/beta hydrolase fold {ECO:0000313|EMBL:ABG52108.1} KW=Complete proteome; Reference proteome OX=203124 OS=Trichodesmium erythraeum (strain IMS101). GN=Tery_2944 OC=Microcoleaceae; Trichodesmium.
Sequence
MNVITSNPTLDNQLRQYNWSWKNHNIQYTMMGTGQPLLLTHGFGASINHWRNNIPLLAKS
GYQVFALDLLGFGASSKPSIDYSMELWEELIYDFWSAHIRQPTVFVGNSIGALLSLMILA
SYPEIATGGILINCAGGLNHRPQELNLPLRFIMGMFTKLVSSPVLGPFIFNQVRQKHRIR
NTLKQVYINKEAVTEELVEIIHRPSCDAGAQKVFASILTAPAGPHPSELLPKIKAPLLVI
WGEKDPWTPISGAQIYQDLADKSGVIQFEPIPNTGHCAHDERPTIVNSLILDWLAKMINM
Download sequence
Identical sequences Q110G6
WP_011612466.1.43450 203124.Tery_2944 gi|113476520|ref|YP_722581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]